PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG128700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 194aa    MW: 21271.9 Da    PI: 7.2156
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG128700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB170.42e-5371166297
                NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                          +eqdr+lPian++rim++++P n+ki+kdake+vqecvsefisf+tseasdkc +ekrktingddl+w+l+tlGfe+yveplk ylk yr
  Pavir.1KG128700.1.p  71 KEQDRYLPIANIGRIMRRAVPDNGKIAKDAKESVQECVSEFISFITSEASDKCMKEKRKTINGDDLIWSLGTLGFEEYVEPLKHYLKLYR 160
                          89**************************************************************************************** PP

                NF-YB  92 elegek 97 
                          e+eg++
  Pavir.1KG128700.1.p 161 ETEGDT 166
                          ****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.0E-4969176IPR009072Histone-fold
SuperFamilySSF471132.33E-3773173IPR009072Histone-fold
PfamPF008081.9E-2676139IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.1E-18104122No hitNo description
PROSITE patternPS006850107123IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.1E-18123141No hitNo description
PRINTSPR006151.1E-18142160No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MSPLHPRHQP PETRLQIRRP VASSPRDHPS QPTALISSAI SVHLRFHRQE GSGMSEAESA  60
PETGGGSYGG KEQDRYLPIA NIGRIMRRAV PDNGKIAKDA KESVQECVSE FISFITSEAS  120
DKCMKEKRKT INGDDLIWSL GTLGFEEYVE PLKHYLKLYR ETEGDTKGSK SSDHTGKKEI  180
VLIGEPGSSL DGV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B7e-4571161494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A7e-4571161494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.192640.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012699849.12e-78PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotQ65XK13e-73NFYB4_ORYSJ; Nuclear transcription factor Y subunit B-4
TrEMBLA0A0A9PIF83e-84A0A0A9PIF8_ARUDO; Uncharacterized protein
STRINGSi024597m7e-74(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.32e-59nuclear factor Y, subunit B1